Synonyms Osteogenic Protein 1, BMP-7.
Type Polyclonal Rabbit Antibody.
Introduction The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
Purity Greater than 98%.
Immunogen IgG Anti BMP-7 has been developed in rabbit using highly pure (>98%) recombinant human BMP-7 expressed in plants.
Antigen Amino Acid Sequence FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF.
Purification Method Purified IgG prepared by affinity chromatography on protein G.
Protein formulation Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.
Solubility Add 100 ul of distilled water to create a final concentration of 1 mg/ml.
Stability/Storage Store at -20°C. For long term storage freezes in working aliquots at -20°C.
Repeated freezing and thawing is not recommended.
Applications Western Blot: to detect human BMP-7 by WB analysis this IgG can be used in a dilution of 1:500. For optimal usage we suggest overnight incubation.
Usage CHI's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.