Synonyms         Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.

 

Type          Polyclonal Rabbit Antibody. 

Introduction            TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-b (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing. 

Purity           Greater than 98%. 

Immunogen IgG Anti Human TGFb-2 is developed in rabbit using recombinant Human TGFb-2 produced in plants. 

Antigen Amino Acid Sequence         ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEA

SASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS 

Purification Method            Purified IgG prepared by affinity chromatography on protein G. 

Protein formulation            Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline. 

Solubility           Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely. 

Stability/Storage          Store at -20°C. For long term storage freezes in working aliquots at -20°C.

Repeated freezing and thawing is not recommended. 

Applications           Western Blot: to detect human TGFb2 by WB analysis this antibody can be used in a dilution of 1/1,000. 

Usage             CHI's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.