Log In  |  Sign Up  |  My Cart()
    Your Position:  Home Products
Recombinant Human Adiponectin

Synonyms    Acrp30, AdipoQ, GBP-28, APM-1, ACDC.
Introduction   The adipose tissue exclusively expresses and secretes Adiponectin (Acrp30). Acrp30 is involved in various physiological processes such as energy homeostasis, insulin sensitivity, hormonal processes, fatty acid metabolism and obesity.
Adiponectin circulates in the plasma. Decreased levels of Adiponectin are associated with insulin resistance and hyperinsulinemia, as seen in people with obesity insulin resistance, and diabetes type 2, whose plasma levels of adiponectin are reduced.
The modular structure of Acrp30 is comprised of N-terminal collagenous domain followed by a C-terminal globular domain.
Acrp30 also acts as a significant negative regulator in hematopoiesis and immune systems; it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin inhibits endothelial NF-kappa-b signaling through a cAMP-dependent pathway, it also inhibits TNF-alpha- induced expression of endothelial adhesion molecules.
Patent Rights 
The sale and/or commercial use of Recombinant Adiponectin is prohibited in the United States of America (U.S.A).
Description     The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244).
Amino Acid Sequence    MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.
Source     Escherichia Coli.
Formulation    Acrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1 mM DTT.
Storage   Store Acrp30 at -20°C. Can be stored at 4°C for a limited period of time of 7 days.
Purity    Acrp30 purity is greater than 90% as determined by SDS-PAGE.
Usage    CHI's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Cat No. Description Unit Price Order
7-00019 Recombinant Human Adiponectin 5 µg $ 103.17 
7-00020 Recombinant Human Adiponectin 25 µg $ 268.25 
7-00021 Recombinant Human Adiponectin 1 mg $ 5142.85 
Ordering Information
Email:order@chiscientific.com
Tel:800.986.6008
Fax:978.897.5462
HOME  |  ABOUT US  |  PRODUCTS  |  SERVICES  |  RESOURCES  |  ONLINE INQUIRY  |  CONTACT USCopyright © CHI Scientific, Inc.. All rights reserved.