Synonyms    NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide. 

Introduction    Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function. 

Description    B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. 

Physical Appearance    Sterile Filtered White lyophilized (freeze-dried) powder. 

Formulation     The protein was lyophilized without additives. 

Solubility     It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H₂O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. 

Stability     Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C.

For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).

Please prevent freeze-thaw cycles. 

Purity    Greater than 98.0% as determined by(a) Analysis by RP-HPLC.

(b) Analysis by SDS-PAGE. 

Amino acid sequence    SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH. 

Usage    CHI's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.