Log In  |  Sign Up  |  My Cart()
    Your Position:  Home Products
Recombinant West Nile Pre-M Virus

Introduction  West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins. 
Description The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag. 
Method Purified by proprietary chromatographic technique. 
Purity  Protein is >95% pure as determined by 10% PAGE (coomassie staining). 
Formulation 20mM phosphate buffer pH 7.5. 
Stability WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C.
Please prevent freeze thaw cycles.
Specificity  Immunoreactive with sera of West Nile virus infected individuals. 
Applications  Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems. 
Amino Acid Sequence
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE. 
Usage CHI's products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals. 

Cat No. Description Unit Price Order
7-07963 Recombinant West Nile Pre-M Virus 100 µg $ 309.52 
7-07964 Recombinant West Nile Pre-M Virus 500 µg $ 1142.85 
7-07965 Recombinant West Nile Pre-M Virus 1000 µg $ 2285.71 
Ordering Information
Email:order@chiscientific.com
Tel:800.986.6008
Fax:978.897.5462
HOME  |  ABOUT US  |  PRODUCTS  |  SERVICES  |  RESOURCES  |  ONLINE INQUIRY  |  CONTACT USCopyright © CHI Scientific, Inc.. All rights reserved.