Introduction West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.
Description The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag.
Method Purified by proprietary chromatographic technique.
Purity Protein is >95% pure as determined by 10% PAGE (coomassie staining).
Formulation 20mM phosphate buffer pH 7.5.
Stability WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C.
Please prevent freeze thaw cycles.
Specificity Immunoreactive with sera of West Nile virus infected individuals.
Applications Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems.
Amino Acid Sequence
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE.
Usage CHI's products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.